| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014553 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151623 | Ga0134451 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS58_6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 106917269 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F055775 | Metagenome | 138 | N |
| F101193 | Metagenome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134451_100454 | Not Available | 29333 | Open in IMG/M |
| Ga0134451_112639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1150 | Open in IMG/M |
| Ga0134451_127708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 573 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134451_100454 | Ga0134451_10045411 | F055775 | MAQIAQQDNLVIEVTTTAKALDSDTKKKLIECIKGGTITDVILVTKEVDKKISHARVVSWLVDTAGSSPKYTIDIINANSGKVEAIALN* |
| Ga0134451_112639 | Ga0134451_1126393 | F026592 | CKTVWRTASPQGIAALAAQGGVATLTERSDATFSVVQFSSADRE* |
| Ga0134451_127708 | Ga0134451_1277081 | F101193 | MARKCTEYHYFQHTYWDVMARYNWMRCPYCGKLCKPSRFKAATVLVPIELVIFVVCIFFRNSMNDAIGWFAAWLLFVLLLFLPQYIYVRFFMPYETLSEDETRKFHELQKN* |
| ⦗Top⦘ |