| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014550 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121299 | Gp0151680 | Ga0134508 |
| Sample Name | Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P788T3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Washington |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 93621065 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp. | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: University of Washington | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059106 | Metagenome | 134 | N |
| F067844 | Metagenome | 125 | N |
| F073656 | Metagenome | 120 | N |
| F097172 | Metagenome / Metatranscriptome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134508_100355 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 20390 | Open in IMG/M |
| Ga0134508_100404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 17865 | Open in IMG/M |
| Ga0134508_100667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 10548 | Open in IMG/M |
| Ga0134508_104242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp. | 2633 | Open in IMG/M |
| Ga0134508_105116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2324 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134508_100355 | Ga0134508_1003551 | F073656 | MERSRRGDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHNYLLDPSTVTEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGAVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFVDPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGAEFHLKRH* |
| Ga0134508_100404 | Ga0134508_1004048 | F097172 | MKRNVLKKMMCAVLTAVCVASAVAPVMADDGMVTVEAATKNVTSAYKYHLEGYDKKGYPVSFSKTSFYKDLNALPTVKTGKTTINVPAVTPSVKSVSKKKSDPTYESFVKFKAPKTGKYVVTLTNLRGTDEKSVKTMYYCGFYKFSKTSKKYNLEGIDFDTVGDCDKLFENNYLEKFRAILDNYKVEHPEYEDAIEDTYEDEVHLVNLYSANKIKFTTKLKKGQTYVFVIDNSGSVFPDTPYNDSFYDGSMSCRRNWNYMEAYSFDLDIQLKK* |
| Ga0134508_100667 | Ga0134508_10066713 | F067844 | MNTLAAETASAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQRRS* |
| Ga0134508_104242 | Ga0134508_1042422 | F097172 | MKKNVFKKLMCAVLATACVATAVVPAMADDVVTAEAATKKVTSAYKYHIDGYDKKGYPIDGFSKTSFYKDLNSLPSVKTGKTTINVPAVTSSVKSVSKEKGEPCYESYVKFKAPKTGKYVVTLDNLQGTDDKSLKSLSCSLCEIAKTGKKYTLSGFEPDCNTVGKYDTLCENNYLARLRTILDNYKAEHPEYADVIEETYEYQKDLVNKYPVDKIKFTTQLKKGQTYVFVIDNRGMDKAVPPYFTTHGSDEQSCLWGGNYLKAYSFDINIEYRK* |
| Ga0134508_105116 | Ga0134508_1051163 | F059106 | RVILLQIFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV* |
| ⦗Top⦘ |