Basic Information | |
---|---|
IMG/M Taxon OID | 3300014542 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151626 | Ga0134454 |
Sample Name | Human fecal microbial communities from obese patients in Germany - AS62_6 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hohenheim |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 88558477 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Obese Patients In Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026489 | Metagenome | 197 | N |
F092227 | Metagenome | 107 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134454_126627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 544 | Open in IMG/M |
Ga0134454_128773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 505 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134454_126627 | Ga0134454_1266272 | F092227 | MNEQKRKRILRAGCLLLAGVFLLSVLGSVILMFLV* |
Ga0134454_128773 | Ga0134454_1287731 | F026489 | ERGGDGGCSLLTPKENQKSASDFDALEPRKRGCSPLLTPKKWAAPKKTEDSRLFGVKIF* |
⦗Top⦘ |