3300014520: Human fecal microbial communities from infant at 4 months in Denmark - 637_4M

Overview

Basic Information

• IMG/M Taxon OID: 3300014520
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127429 | Gp0193849 | Ga0169862
• Sample Name: Human fecal microbial communities from infant at 4 months in Denmark - 637_4M
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 48589621
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076191	Metagenome	118	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0169862_10792	Not Available	10819

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169862_10792	Ga0169862_107929	F076191	MKIIAENPAEEALLWRIKALSDELVNQDNRYTSMPVWTILDNNKAGKDYGAVMYFTGKAAEQHIKENVHHYEKPMTCIRSAHDNRELKDVIHLLILAGGNEIPSNHYGFLRDA*