| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014506 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121288 | Gp0151325 | Ga0134302 |
| Sample Name | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0160 : 32 days incubation |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Battelle Memorial Institute, Gulf Coast Restoration Organization |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9629986 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal water body → coastal sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Norway: Trondheimsfjord | |||||||
| Coordinates | Lat. (o) | 63.43 | Long. (o) | 10.43 | Alt. (m) | N/A | Depth (m) | 90 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047315 | Metagenome / Metatranscriptome | 150 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134302_100005 | All Organisms → cellular organisms → Bacteria | 10684 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134302_100005 | Ga0134302_1000054 | F047315 | MSTMTDYDAGRLVTQIENLSKQVESLNTTTVTLSKRINELEKQLVKGKGFLAGAMLLSMGLGGVGTSFLAKWLGT* |
| ⦗Top⦘ |