Basic Information | |
---|---|
IMG/M Taxon OID | 3300014291 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121296 | Gp0151539 | Ga0134367 |
Sample Name | Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_137 |
Sequencing Status | Permanent Draft |
Sequencing Center | The George Washington University (GWU) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 47421140 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonas → Candidatus Saccharimonas aalborgensis | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078842 | Metagenome | 116 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134367_100203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonas → Candidatus Saccharimonas aalborgensis | 15110 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134367_100203 | Ga0134367_1002031 | F078842 | MIISSIYKTVDNDGLIAHIYEHLLAQYVLKRLQDNEFFVLSDIILSAKTYGDTCFMDAELYSSEVKKTYDEALREFDKIVIPEDDILRAASECGIEMNRNIVEVDRSELSKKLREVQISPWRKQIDMAYRKAHDESSVNTLFRTSYIKYSKESDDLFRECVLEYSIDESHMQTPVDQALAAIVMQIVALNFLTVVREKYTVYDRGDQWSEASISVGYRMFLGLLKKDDKIINQLSYDFLEYIKSLSSSVFCDNLQKALVRCSDNHKQVILNRSTLNAILGGCVIGGKGWLGKGGRGPKKEKG |
⦗Top⦘ |