| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014135 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121296 | Gp0151532 | Ga0134360 |
| Sample Name | Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_043 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | The George Washington University (GWU) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 44811661 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067847 | Metagenome | 125 | N |
| F071329 | Metagenome | 122 | N |
| F097527 | Metagenome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134360_100085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 36024 | Open in IMG/M |
| Ga0134360_101188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 4534 | Open in IMG/M |
| Ga0134360_101647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3581 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134360_100085 | Ga0134360_1000853 | F071329 | MRPIYSKGILMLPVAKIIISGLSSIGAGMIASRLTKPIVSNSRGICKILLWFGSVGTGIAASAIVAREVEKQFDETVKAVKDARDQIEIED* |
| Ga0134360_101188 | Ga0134360_1011887 | F097527 | MIYFKMEKIGNSTLNKEKKTRSENLVFNTIPAAGVEPARPCGHWILS |
| Ga0134360_101647 | Ga0134360_1016474 | F067847 | MFTHIVRVKGFFDDEPKAKKLYFHLSRREMFDFIRQYDNIKNFNEWVQSAIDAEDLYTLMEFFDNLIGTSYGERQGDHFVKTPQIKESFLNSPEYEKLFDEFMDNPGLVKQFYEGILPEKIMNQVKRDEKYSEIEEKLKETELKNL* |
| ⦗Top⦘ |