3300014133: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_019

Overview

Basic Information

• IMG/M Taxon OID: 3300014133
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121296 | Gp0151530 | Ga0134358
• Sample Name: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_019
• Sequencing Status: Permanent Draft
• Sequencing Center: The George Washington University (GWU)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 27485950
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal secretion

Location Information

• Location: USA: Maryland
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063778	Metagenome	129	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134358_106758	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces	723

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134358_106758	Ga0134358_1067581	F063778	QLQEALGLVADADTSAHDVAAITHSAADGHQLTEVMLQQMMAARGYLKSCADQIECAISNIKAIPLDPPPED*