| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014025 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113963 | Gp0134630 | Ga0119800 |
| Sample Name | Human oral microbial communities from Los Angeles, CA, USA - S13-04-R |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Los Angeles |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 162485660 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Los Angeles | |||||||
| Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043991 | Metagenome | 155 | N |
| F097490 | Metagenome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119800_100626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34194 | Open in IMG/M |
| Ga0119800_116774 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1295 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119800_100626 | Ga0119800_10062614 | F043991 | MSKKNPSVIDYFDLNGDLNEEAYEFEDVKLEEYIDKRSNVNPAWVGKYSHQMHFDLPDDTEVSFYKGLNIVYADINFAGGIRTILFKCRQKKNLTRFISRVLEIAQGDPSNVHPDFRA* |
| Ga0119800_116774 | Ga0119800_1167742 | F097490 | MFLKTQKINKKMNVFYRIILPLLCIISCSKRKEIEVYNMELDENKKEVLVEIRNNTENNYYLLSPIVSIMTKHLQDIGVEMIEGQIHHKKLDSIVYSVCIWDDICKEEYYAMRDIVLLPKKSVKKIKYKYDNEKYIEIETVHIGFPYNGYYNEIGKKMQFMLKKKLDSSNIIKGYEFYNKDIETMTIKM* |
| ⦗Top⦘ |