| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013966 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118603 | Gp0137825 | Ga0120336 |
| Sample Name | Human oral microbial communities from various locations - University of British Columbia - SCG38 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of British Columbia |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 342242 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043991 | Metagenome | 155 | N |
| F051214 | Metagenome | 144 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120336_1007 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120336_1007 | Ga0120336_10071 | F043991 | MSKKNPSVIDYFDLNGDLNEEAYEFEDVKLEEYIDKRSNVKPSWVGKYSHQMHFDLPDDTEVSFYKGLNIVYADINFVGGIRTILFKCRQKKNLTRFISRVLEIAQGDPSNVHPDFRA* |
| Ga0120336_1007 | Ga0120336_10072 | F051214 | MPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYREKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVIRVFLHDEDITIKPIYIYNNREYQIACEFLRQVMHDMIDLKDEWIV* |
| ⦗Top⦘ |