3300013936: Baboon gut microbial communities from fecal samples in Kenya - F28

Overview

Basic Information

• IMG/M Taxon OID: 3300013936
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118445 | Gp0134437 | Ga0116637
• Sample Name: Baboon gut microbial communities from fecal samples in Kenya - F28
• Sequencing Status: Permanent Draft
• Sequencing Center: Duke University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 80021757
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Baboon Gut Microbial Communities From Fecal Samples In Kenya
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Coordinates
  • Lat. (^o): 2.717
  • Long. (^o): 37.1
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0116637_1005805	Not Available	1529

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116637_1005805	Ga0116637_10058053	F036964	MEILKIIFPLLMVAGALGSLVVNIASKGDWATSLQWLGACLLYTALTVRNMS*