3300013903: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 244

Overview

Basic Information

• IMG/M Taxon OID: 3300013903
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118643 | Gp0137841 | Ga0117802
• Sample Name: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 244
• Sequencing Status: Permanent Draft
• Sequencing Center: Chalmers University of Technology
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 78210925
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0117802_1001755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	3213

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0117802_1001755	Ga0117802_10017551	F067844	MNTLAAETTSAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAARIN