| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013901 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118445 | Gp0134452 | Ga0116652 |
| Sample Name | Baboon gut microbial communities from fecal samples in Kenya - M12 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Duke University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 86287825 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Baboon Gut Microbial Communities From Fecal Samples In Kenya |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| F092227 | Metagenome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0116652_1003693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 2409 | Open in IMG/M |
| Ga0116652_1010697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1150 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0116652_1003693 | Ga0116652_10036932 | F092227 | MKEQKQKRWLRIGCLILAGVFALSLLGSVIMMLLY* |
| Ga0116652_1010697 | Ga0116652_10106971 | F032286 | FDTRLFAGNAADDTLVTGSTFRFCRLVCLFVKRRNIILNSKRRSLLNRTLFRADNRTEQKTISPFSLSLIFTFDFAALSERRSCPGLSPRRFVLLGALDATLRRRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDRKRAEI* |
| ⦗Top⦘ |