3300013796: Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_IW_meta

Overview

Basic Information

• IMG/M Taxon OID: 3300013796
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118583 | Gp0137232 | Ga0119890
• Sample Name: Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_IW_meta
• Sequencing Status: Permanent Draft
• Sequencing Center: Nanjing University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 94199925
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: China: Nanjing
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102832	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119890_1000143	Not Available	7376

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119890_1000143	Ga0119890_10001431	F102832	MENKQKSSGEAHSEPLQQCNVVGSYYLVRYSGGSYDDYYSAVIFVTNKKSTATKYCSKFNKALKRWKDYYKQFETDKFGMKWISDEHVENHFDRWNSLQNITKCYYEEVPFR*