| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013790 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118583 | Gp0137230 | Ga0119888 |
| Sample Name | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_AS_meta |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Nanjing University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 50769435 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Nanjing | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003544 | Metagenome / Metatranscriptome | 480 | Y |
| F005782 | Metagenome | 390 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119888_1015296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| Ga0119888_1016418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119888_1015296 | Ga0119888_10152961 | F005782 | RLGEIVKVMLARRRLATWGATGGPWDVKDISQTGFRLIAPMSAASAVTLNTLAAIRPYGHAFWTLGIVRRMRRLTSDRAEIGLQVIANTLIGVELCEQKRGSESPYSVEGENSTLDGRAFAGLFLALRKREGESAVQSLIVPAVEYQPAPRESSRHATSAPTRSALM* |
| Ga0119888_1016418 | Ga0119888_10164181 | F003544 | ALIAEAAEHQAQEIAGAATAYKAALVVLLFDRGISGKIAGQEIRSLRQSLPPTMPRMVSGRAVNLLAKPIPDVRTAVDFSSVMASIRDLGVLPATPVALVGVVPQEPQRA* |
| ⦗Top⦘ |