| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013753 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113963 | Gp0134639 | Ga0119809 |
| Sample Name | Human oral microbial communities from Los Angeles, CA, USA - S20-01-D |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Los Angeles |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 233713808 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Los Angeles | |||||||
| Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076191 | Metagenome | 118 | N |
| F084362 | Metagenome | 112 | N |
| F095630 | Metagenome | 105 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119809_1000336 | Not Available | 42944 | Open in IMG/M |
| Ga0119809_1000406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 37965 | Open in IMG/M |
| Ga0119809_1016739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 2207 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119809_1000336 | Ga0119809_100033653 | F084362 | MNCAFTVRWSDEKNKPHAKTYATEVDAKRAKKWLLEHGVRSVDIAVKINNKPAGSLKDDKPSETDAEQKGFWWEK* |
| Ga0119809_1000406 | Ga0119809_100040637 | F076191 | MKIIAENPAEEALLWRIKSLSDELVDQDNRYTSMPVWTILDNNKAGKDYGAVMYFTGKAAEQHINENDHHYENPTTYIRSAHDNRELKDVIHLLILAGGNEIPSNHYGVLRDA* |
| Ga0119809_1016739 | Ga0119809_10167392 | F095630 | MYSSLYKISKDNGLLAHVYEHLLAQYVLKYLQDKGFFISSDIILTAKTYGDTCFIDAELYSPVAQRAYGEALRLFDEWDIPGDAALRAAGECGIEMNRVVAELKQDELLRSLNMVQLSAWHQQSDLTYRKAYDKSSVNTLFRVPYIKYSRKSKSLFPEYVLEYSVDEKYIQSSIDQALAAVVIQAVALNFLVMIREKHTVYDRGDQWSEASKSVGYRMFLGLIKKDDNIVDQLKREFMEYMQFLSASSFCDNLQAALVRCSHNHEQVLLGRDTLNSILGGCVIGGEGWLKMADNKLIGQILKAIEIDVYDI* |
| ⦗Top⦘ |