| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013742 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118456 | Gp0134832 | Ga0116839 |
| Sample Name | Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S3-Shot-B61-calc |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Oklahoma |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 47898252 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossilized Dental Plaque → Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany: Dalheim | |||||||
| Coordinates | Lat. (o) | 51.565093 | Long. (o) | 8.849015 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051211 | Metagenome | 144 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0116839_1009662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 813 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0116839_1009662 | Ga0116839_10096621 | F051211 | MRVKKAIKIFEKIRDLPYGTSGSDEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPIPEHILSLRRQRYERHVILRVFIDGSAYDIDPSIDIGLAPTLPIAHWDGTSSTATMASLKHLRVYRPHSLHERILSRLRSKFFRGNPKEFYTAIDKWLADTRTHQSS* |
| ⦗Top⦘ |