Basic Information | |
---|---|
IMG/M Taxon OID | 3300013742 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118456 | Gp0134832 | Ga0116839 |
Sample Name | Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S3-Shot-B61-calc |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Oklahoma |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 47898252 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossilized Dental Plaque → Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany: Dalheim | |||||||
Coordinates | Lat. (o) | 51.565093 | Long. (o) | 8.849015 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051211 | Metagenome | 144 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0116839_1009662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 813 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0116839_1009662 | Ga0116839_10096621 | F051211 | MRVKKAIKIFEKIRDLPYGTSGSDEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPIPEHILSLRRQRYERHVILRVFIDGSAYDIDPSIDIGLAPTLPIAHWDGTSSTATMASLKHLRVYRPHSLHERILSRLRSKFFRGNPKEFYTAIDKWLADTRTHQSS* |
⦗Top⦘ |