3300013727: Human skin bacterial and viral communities - University of Pennsylvania - MG100397

Overview

Basic Information

• IMG/M Taxon OID: 3300013727
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138061 | Ga0118124
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100397
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 14923928
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020828	Metagenome / Metatranscriptome	221	Y
F054614	Metagenome / Metatranscriptome	139	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118124_103567	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	638

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118124_103567	Ga0118124_1035671	F020828	WPNEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGKMDAEKLVTDAPPPGKEYRTPKMYYKSVLKGARTIAGECSKDVIFE*
Ga0118124_105837	Ga0118124_1058371	F054614	MSFTLTLSGRSSVLAVDYFPPIDLSDREYELGLTTLETYNTIPNVTSANNKFYYGDKDEEITIPEGSYEIDAISAYLKHVILQKLRKNTEKDDNVL