NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013617

3300013617: Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (liquid nitrogen) - PDam_LN2_DNA_MDA



Overview

Basic Information
IMG/M Taxon OID3300013617 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118633 | Gp0137666 | Ga0117785
Sample NameCoral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (liquid nitrogen) - PDam_LN2_DNA_MDA
Sequencing StatusPermanent Draft
Sequencing CenterAustralian Institute of Marine Science
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8863627
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCoral Viral Communities From The Great Barrier Reef, Australia
TypeHost-Associated
TaxonomyHost-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationAustralia: Great Barrier Reef
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000713Metagenome / Metatranscriptome925Y
F029759Metagenome / Metatranscriptome187Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0117785_100045Not Available2305Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0117785_100045Ga0117785_1000451F029759MFINIYAFYALLACNLSVFLFALYAHARVRANEKVLLDLDWETLADLTGQVGALKRSLQKTNNRINGMTSSDPVSVLSELPVLQQAPQVQNGQFNGG*
Ga0117785_100045Ga0117785_1000453F000713MPLVKKRLTIAAGATSDQVLQGTTYEYVDPGTRLVVAAADNSGTYSGDVVMNFTVNNAEFAKDTVVSEGVSGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNDSASATIDVAVFIGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.