| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013617 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118633 | Gp0137666 | Ga0117785 |
| Sample Name | Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (liquid nitrogen) - PDam_LN2_DNA_MDA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Australian Institute of Marine Science |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8863627 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Coral Viral Communities From The Great Barrier Reef, Australia |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Australia: Great Barrier Reef | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000713 | Metagenome / Metatranscriptome | 925 | Y |
| F029759 | Metagenome / Metatranscriptome | 187 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0117785_100045 | Not Available | 2305 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0117785_100045 | Ga0117785_1000451 | F029759 | MFINIYAFYALLACNLSVFLFALYAHARVRANEKVLLDLDWETLADLTGQVGALKRSLQKTNNRINGMTSSDPVSVLSELPVLQQAPQVQNGQFNGG* |
| Ga0117785_100045 | Ga0117785_1000453 | F000713 | MPLVKKRLTIAAGATSDQVLQGTTYEYVDPGTRLVVAAADNSGTYSGDVVMNFTVNNAEFAKDTVVSEGVSGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNDSASATIDVAVFIGG* |
| ⦗Top⦘ |