Basic Information | |
---|---|
IMG/M Taxon OID | 3300013499 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113963 | Gp0134636 | Ga0119806 |
Sample Name | Human oral microbial communities from Los Angeles, CA, USA - S17-02-D |
Sequencing Status | Permanent Draft |
Sequencing Center | University of California, Los Angeles |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 94866910 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonas → unclassified Candidatus Saccharimonas → Candidatus Saccharimonas sp. | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Oral Microbial Communities From Los Angeles, Ca, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Los Angeles | |||||||
Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022002 | Metagenome | 216 | Y |
F066860 | Metagenome | 126 | N |
F103430 | Metagenome | 101 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0119806_1027182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 672 | Open in IMG/M |
Ga0119806_1029989 | Not Available | 629 | Open in IMG/M |
Ga0119806_1030342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonas → unclassified Candidatus Saccharimonas → Candidatus Saccharimonas sp. | 625 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0119806_1027182 | Ga0119806_10271822 | F066860 | IDMTTKKQKLQKQQTIDRWIVIALWASAIWFSLARGFITGIGGWVLALLGPWALIVSCICLAIISRQVKKRHASKVHLTTIVRVSFIVMSISLFICGLAMPDFSDIETFSTLSVYTNNAISFETSKAIAIISGFVVVLSLFVAVTFGIAEDREETTEDVTI* |
Ga0119806_1029989 | Ga0119806_10299891 | F022002 | MSSRLALTLGLLLALLLSLPSYAQDGQSKEPINRTISGFTLGVTTPAEARAIIQRQGGKIILEGGTHAGSNDVSYTVTGLNYARRPTQTVAMFFYKGHLHSIDFIFDGWDVLEQIESELEDKYGTMAEGVGTSNMKSKVVFDAFTRLLVVRGFKHEGYFGFKDAYIIYS |
Ga0119806_1030342 | Ga0119806_10303421 | F103430 | MIEQITIKAFIGSDNKTKKLEVDKIISIVNINHEAFTLDYPVVGYWRGEAEETAVLYLSDERQKVMNTLSELKE |
⦗Top⦘ |