| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013392 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127568 | Gp0198145 | Ga0180015 |
| Sample Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S2_MetaG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 145904395 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → planetary subsurface zone → groundwater |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Finland: the Olkiluoto Island | |||||||
| Coordinates | Lat. (o) | 61.2418 | Long. (o) | 21.4803 | Alt. (m) | N/A | Depth (m) | 410 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056321 | Metagenome / Metatranscriptome | 137 | N |
| F061521 | Metagenome / Metatranscriptome | 131 | Y |
| F065254 | Metagenome | 128 | Y |
| F093357 | Metagenome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0180015_1007332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2213 | Open in IMG/M |
| Ga0180015_1051903 | Not Available | 656 | Open in IMG/M |
| Ga0180015_1063741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 580 | Open in IMG/M |
| Ga0180015_1069159 | Not Available | 553 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0180015_1007332 | Ga0180015_10073323 | F065254 | VALNKGSEQAEKASVATETLLWGCPITNFKATLPFNRMNQSRRGGIAAFKKRPHGPALARFKGYN* |
| Ga0180015_1051903 | Ga0180015_10519031 | F061521 | MNEAQVRIEIERIVNLVVGFGWTKVEEKTSAGEVLLTLRKAVPVTSVS* |
| Ga0180015_1063741 | Ga0180015_10637412 | F093357 | MERIIQKKMKNFEQAWQIKRFLAERGESISSLSRKLNRPFGSVANNIYGYRANAQLQREIADFLGKPVAKLFGGAGPVRG* |
| Ga0180015_1069159 | Ga0180015_10691592 | F056321 | METPAPTPIIYVHVEFYRGVKAIAQFLGVHERTAQAFLHDGKIPGKKDGTGTWVLTNLDYFTSLQR* |
| ⦗Top⦘ |