3300013292: Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-08

Overview

Basic Information

• IMG/M Taxon OID: 3300013292
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118444 | Gp0134403 | Ga0120683
• Sample Name: Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-08
• Sequencing Status: Permanent Draft
• Sequencing Center: Weill Cornell Medical College
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 80570099
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
• Type: Engineered
• Taxonomy: Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA:New York City
• Coordinates
  • Lat. (^o): 40.67
  • Long. (^o): -73.98
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058437	Metagenome / Metatranscriptome	135	Y
F058743	Metagenome / Metatranscriptome	134	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0120683_1003348	Not Available	845

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120683_1003348	Ga0120683_10033482	F058437	LFADSGAADVAVREEAHAMMRALNQIEMKLDAAITAETFLDRKQRK*
Ga0120683_1016703	Ga0120683_10167031	F058743	KMSFIWSCFAYMGTERQIKTVKSWAYKTNIDTEEDRDNYWHQHLREGSLSLSGVYYLHLPEGVNLETSGTEFSHTTPEDVDNRFFAPAKVGHWVIWPGKAWHRPGILESKDWRYIVAADMEL*