3300013288: Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90709

Overview

Basic Information

• IMG/M Taxon OID: 3300013288
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118585 | Gp0137255 | Ga0119913
• Sample Name: Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90709
• Sequencing Status: Permanent Draft
• Sequencing Center: California Institute of Technology
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 15408728
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Australia: Queensland
• Coordinates
  • Lat. (^o): -27.49999
  • Long. (^o): 153.01209
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100051	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119913_100633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22	2196

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119913_100633	Ga0119913_1006334	F100051	MLERLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVSGAGTASAGLPG*