3300013219: Human skin bacterial and viral communities - University of Pennsylvania - MG100532

Overview

Basic Information

• IMG/M Taxon OID: 3300013219
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138182 | Ga0118245
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100532
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 23698314
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101360	Metagenome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118245_103359	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	749

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118245_103359	Ga0118245_1033592	F101360	MSKEDALRRAAVAAHVAKVASQEKKRALAELEEVMAPGDTSRPMIDGLQVGTVSVSAPAPKYQVVDERALVAWLEWNKPDAVHKVPAPWFTAAAALDGFIKQTGEIPDGVEVVQGDPRISVRISTAQAAAIQELIASGDIRMIEVGGD*