3300013075: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 30_C Kraft OP (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300013075
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127392 | Gp0191772 | Ga0164288
• Sample Name: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 30_C Kraft OP (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 91951012
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → anthropogenic environment → compost
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Emeryville, California
• Coordinates
  • Lat. (^o): 37.83
  • Long. (^o): -122.29
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040613	Metagenome / Metatranscriptome	161	Y
F045895	Metagenome / Metatranscriptome	152	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0164288_1061851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	616
Ga0164288_1082033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	898

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0164288_1061851	Ga0164288_10618511	F040613	QLIVERGALLHHALGARAVVPEFGILGLSVQLGQPCRRRVEVKDASSAVPRTA*
Ga0164288_1082033	Ga0164288_10820331	F045895	EVMIRAFLEEAAALASVTLFIGMIAIWAQVFSTF*