x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300013070
3300013070: Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C Kraft BY (Metagenome Metatranscriptome)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300013070 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127392 | Gp0191752 | Ga0164271 |
| Sample Name | Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C Kraft BY (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 61672761 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Variosea → Cavosteliida → Cavosteliaceae → Planoprotostelium → Planoprotostelium fungivorum | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | USA: Emeryville, California |
| Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F004148 | Metagenome / Metatranscriptome | 450 | Y |
| F057456 | Metagenome / Metatranscriptome | 136 | N |
| F064972 | Metagenome / Metatranscriptome | 128 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0164271_1015038 | Not Available | 2463 | Open in IMG/M |
| Ga0164271_1036820 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Variosea → Cavosteliida → Cavosteliaceae → Planoprotostelium → Planoprotostelium fungivorum | 696 | Open in IMG/M |
| Ga0164271_1100423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0164271_1015038 | Ga0164271_10150381 | F057456 | IPSVAFPIIQDLSLLHLVILRPAYATVRFVVNQTVRHDLAVEPIK* |
| Ga0164271_1036820 | Ga0164271_10368201 | F004148 | MGGNNVKGLYWMETIYPMPNGQSVIPPEKLQKEFEKGTLRPPDPNAEKEVDGDMDEKIDKVIQDIWNFYDPKGTGIMPKKVMEKFFKDALDLYALRMGKKSSKEVMPPGVKYGEAMAQSLAKITSNPQQATKKEFEDFLNCYDLEEALGSFLNISEISVSNNVQFVDTSQFKEQAAQPKKVVYRDYSVLQND* |
| Ga0164271_1100423 | Ga0164271_11004232 | F064972 | MAESKSTQSLVFPVTDKPHAPFVFFESAPATGFTNGVVNITLAANRTWIEDGKAMNEQVVVAYLRGNIQAALSLRQAIDNALMLASSQQTETKGS* |