NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013019

3300013019: Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 5H_2016_07_13



Overview

Basic Information
IMG/M Taxon OID3300013019 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118431 | Gp0191411 | Ga0163226
Sample NameSubsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 5H_2016_07_13
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size39060901
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSubsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zoneoil field production water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: West Virginia
CoordinatesLat. (o)39.6018Long. (o)-79.9761Alt. (m)N/ADepth (m)2295
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087432Metagenome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0163226_1000018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes37832Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0163226_1000018Ga0163226_100001878F087432VINLIIYENGEYTPCTYRVTLQNKGVEETHYANFRTYWEDMVAKHEYLTNLSFEEITFSAEQDARLQEISELNIPQGFQAEVKEYVENGNFPEGLNNPLAGLKYKKEMNDAYKMILESEGLI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.