| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013019 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118431 | Gp0191411 | Ga0163226 |
| Sample Name | Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 5H_2016_07_13 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 39060901 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → oil field production water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.6018 | Long. (o) | -79.9761 | Alt. (m) | N/A | Depth (m) | 2295 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087432 | Metagenome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0163226_1000018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 37832 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0163226_1000018 | Ga0163226_100001878 | F087432 | VINLIIYENGEYTPCTYRVTLQNKGVEETHYANFRTYWEDMVAKHEYLTNLSFEEITFSAEQDARLQEISELNIPQGFQAEVKEYVENGNFPEGLNNPLAGLKYKKEMNDAYKMILESEGLI* |
| ⦗Top⦘ |