3300013015: Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 3H_2016_09_14

Overview

Basic Information

• IMG/M Taxon OID: 3300013015
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118431 | Gp0191407 | Ga0163222
• Sample Name: Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 3H_2016_09_14
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 16240183
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → planetary subsurface zone → oil field production water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: West Virginia
• Coordinates
  • Lat. (^o): 39.6017
  • Long. (^o): -79.9761
  • Alt. (m): N/A
  • Depth (m): 2281

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087432	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0163222_100094	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	7485

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0163222_100094	Ga0163222_1000946	F087432	MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI*