NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012945

3300012945: Dysideidae sponge tissue microbial communities from Piti Bomb Holes, Guam, USA - SP5 SP5_idba_062615



Overview

Basic Information
IMG/M Taxon OID3300012945 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0126303 | Gp0177891 | Ga0164229
Sample NameDysideidae sponge tissue microbial communities from Piti Bomb Holes, Guam, USA - SP5 SP5_idba_062615
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of California, San Diego, Scripps Institute of Oceanography
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size88985024
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGuam Dysideidae Sponge Holobiont Metagenomes
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Sponge → Unclassified → Unclassified → Sponge Tissue → Guam Dysideidae Sponge Holobiont Metagenomes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationGuam, USA
CoordinatesLat. (o)13.345738Long. (o)144.638186Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024317Metagenome / Metatranscriptome206Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0164229_101738All Organisms → cellular organisms → Bacteria6521Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0164229_101738Ga0164229_10173812F024317MNYEEMDEEFASLVKMAWDSQMEVEVIFEALKTMQLHPHATPKLALQIGLSEWDK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.