3300012945: Dysideidae sponge tissue microbial communities from Piti Bomb Holes, Guam, USA - SP5 SP5_idba_062615

Overview

Basic Information

• IMG/M Taxon OID: 3300012945
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0126303 | Gp0177891 | Ga0164229
• Sample Name: Dysideidae sponge tissue microbial communities from Piti Bomb Holes, Guam, USA - SP5 SP5_idba_062615
• Sequencing Status: Permanent Draft
• Sequencing Center: University of California, San Diego, Scripps Institute of Oceanography
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 88985024
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Guam Dysideidae Sponge Holobiont Metagenomes
• Type: Host-Associated
• Taxonomy: Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Sponge Tissue → Guam Dysideidae Sponge Holobiont Metagenomes

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Guam, USA
• Coordinates
  • Lat. (^o): 13.345738
  • Long. (^o): 144.638186
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024317	Metagenome / Metatranscriptome	206	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0164229_101738	All Organisms → cellular organisms → Bacteria	6521

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0164229_101738	Ga0164229_10173812	F024317	MNYEEMDEEFASLVKMAWDSQMEVEVIFEALKTMQLHPHATPKLALQIGLSEWDK*