3300012859: Enriched soil microbial communities from UW Madison campus, WI, USA - DID2934_E24 MG

Overview

Basic Information

• IMG/M Taxon OID: 3300012859
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121620 | Gp0191488 | Ga0160482
• Sample Name: Enriched soil microbial communities from UW Madison campus, WI, USA - DID2934_E24 MG
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 135709802
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → university campus → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Madison, Wisconsin
• Coordinates
  • Lat. (^o): 43.073
  • Long. (^o): -89.4011
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099558	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0160482_104852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2500

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0160482_104852	Ga0160482_1048523	F099558	MSVSNTSYKLVPSISRRDRTLVSRLVSAILSQWPERTRGSPPLPNYLRRDVGLEPLEPSRKHWDHQ*