| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300012824 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0191458 | Ga0160469 |
| Sample Name | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 84891590 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Madison, Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063045 | Metagenome / Metatranscriptome | 130 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0160469_118936 | Not Available | 537 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0160469_118936 | Ga0160469_1189361 | F063045 | MNKLIASVVFVFALIPLAHAQETIGDKAQEVKGEAVQAKRAAGANIREAGREVKSTARKADRAVRTLCADGRHTIKGAAGCEGHGGVSRTN* |
| ⦗Top⦘ |