3300012660: Human skin bacterial and viral communities - University of Pennsylvania - MG100576

Overview

Basic Information

• IMG/M Taxon OID: 3300012660
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138226 | Ga0118289
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100576
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 44468785
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078089	Metagenome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118289_117132	Not Available	588

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118289_117132	Ga0118289_1171321	F078089	MGSPEGRIIEQAYVILLKLDKNKEVLVSNDWGKIGKKT*