3300012607: Human skin bacterial and viral communities - University of Pennsylvania - MG100535

Overview

Basic Information

• IMG/M Taxon OID: 3300012607
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138185 | Ga0118248
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100535
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 17047444
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027342	Metagenome	195	Y
F076912	Metagenome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118248_106076	Not Available	605
Ga0118248_107510	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	550

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118248_106076	Ga0118248_1060761	F076912	LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS*
Ga0118248_107510	Ga0118248_1075101	F027342	LPCSVSDAAALYRGEVGSSTEKVFWSQYAEAGHPVPPSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPESYFGLVRRLVDVCPWIEVVKCSVCIEGARRALARAKVHWGKLDAEKLLTDAPPPGKEYRTPEMYYKGVLKGARLIAGECSKDVIFE*