3300012572: Human skin bacterial and viral communities - University of Pennsylvania - MG100745

Overview

Basic Information

• IMG/M Taxon OID: 3300012572
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138386 | Ga0118497
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100745
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 14815920
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046965	Metagenome / Metatranscriptome	150	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118497_105736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	505

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118497_105736	Ga0118497_1057361	F046965	FNVCNTTISDLRTKNDMLHAKVVELKSCKPSTSIVEHTSICTRCRDVDINAIHDHMALIKQQNDHIALLDAKIAEHNLENEKFKFARSMLYNGRRPGIKDGIGFQRGDNVELSAPPKRLSNFVKGKAPMPQDNEGYILYPAGYPESKIRRIHSRKSPSGPNHAFMYK