NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012344

3300012344: Baboon gut microbial communities from fecal samples in Kenya - M10



Overview

Basic Information
IMG/M Taxon OID3300012344 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118445 | Gp0134450 | Ga0116650
Sample NameBaboon gut microbial communities from fecal samples in Kenya - M10
Sequencing StatusPermanent Draft
Sequencing CenterDuke University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size108673165
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBaboon Gut Microbial Communities From Fecal Samples In Kenya
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
Location
CoordinatesLat. (o)2.717Long. (o)37.1Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032286Metagenome / Metatranscriptome180Y
F042737Metagenome / Metatranscriptome157Y
F063247Metagenome / Metatranscriptome129Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0116650_1002723Not Available3614Open in IMG/M
Ga0116650_1027108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes736Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0116650_1002723Ga0116650_10027238F063247MKKYPRTSTIEIDCDPCTGMGRQQNHYEAICKLLNVKPEPRISAFFGCWEWPITYKTAEDEAKAKEFLTDLYNSGLCRYASW*
Ga0116650_1027108Ga0116650_10271081F032286MVKWVCQTVTPVRHRALIFDARLFAGNAADDTLVTGSTFRFCRLVCLFVKRRNIILNSKRRSLLNSSLFRADNRTEQKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVPVGTLTLLRSWRLLRWGTYPVRTVMQFS
Ga0116650_1038475Ga0116650_10384751F042737NAIGRASRSVGANVTDLQKKGLVEREKVEVEGADKPVVYVNLTDAGATFVPGEDAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.