NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012337

3300012337: Human skin bacterial and viral communities - University of Pennsylvania - MG100586



Overview

Basic Information
IMG/M Taxon OID3300012337 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118646 | Gp0138236 | Ga0118302
Sample NameHuman skin bacterial and viral communities - University of Pennsylvania - MG100586
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Pennsylvania
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22597517
Sequencing Scaffolds8
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii1
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Skin Bacterial And Viral Communities - University Of Pennsylvania
TypeHost-Associated
TaxonomyHost-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006329Metagenome / Metatranscriptome376Y
F020492Metagenome223Y
F020828Metagenome / Metatranscriptome221Y
F027342Metagenome195Y
F037171Metagenome / Metatranscriptome168N
F038003Metagenome / Metatranscriptome167Y
F076912Metagenome117Y
F094706Metagenome105Y
F103019Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0118302_102207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii1429Open in IMG/M
Ga0118302_104128Not Available957Open in IMG/M
Ga0118302_104173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis952Open in IMG/M
Ga0118302_105718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae781Open in IMG/M
Ga0118302_106357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae734Open in IMG/M
Ga0118302_109335Not Available581Open in IMG/M
Ga0118302_109614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum571Open in IMG/M
Ga0118302_109849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum563Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0118302_102207Ga0118302_1022071F006329LLKEKIKKIEEEKMILELHVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYAVGSIVTLVAIMIAFVFALKCFT*
Ga0118302_104128Ga0118302_1041282F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSKSVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS*
Ga0118302_104173Ga0118302_1041731F037171MYVCARIENDPVEEPEEFAGEAPEQQSFGGGKCPLTYLCPIHSLIHLPLYTFMPKD*
Ga0118302_105718Ga0118302_1057181F094706MGPAHGGFEFLKGSFEGLKGYAVGRMTKSRRGKLYIDDAGWGPEADSIEYGYRVPFGGMHVFIGKIGEPGPEPDICTDLVETAQRARSTQAKPAVKRAFVGVIHGGGREDESEHGSEAVVYSGDESSTGET
Ga0118302_106357Ga0118302_1063571F038003PSAPTGGASGVDLAFETKASVVPPRHTNPEQVDDASALAEGLQDVALVPETTVQPVPDVTTSLLVDQKVLTNSHLTSFRLGLNPPSDLALAGALVEASATPLGFRMRSPWDRLTDVSTYGPSGSEEDDDPIICWDFSGLGNPSAMRDFMTACDYCLSDCSDGSRSLGDESCGPSRECFHIELGDPSEGNHLGMPEDGDLPRPVPRADIPRELAVVPVPAGGHDPQLEQVRGAQARLDEGVGALE
Ga0118302_109335Ga0118302_1093352F020492MGLQAALLTSAALTEEVDALKQSLERSENELGRAKKQLEDKEGE*
Ga0118302_109614Ga0118302_1096142F020828MKGLIVQMWPGEPLPGSYFGLVKCLVNACPRFEVIKRSVCIEGAHRAFSRAKVHWAKMDAEKLVKEGPPEGKEHRHPEMYYEGVLPGARLIADECSKDVIFE*
Ga0118302_109849Ga0118302_1098491F027342SLERDSKTRESELASTLESAKAAKAEAHKALQEIEALKKIAAGKAFFMQSKHVNVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALACAKVHWGKMDAE
Ga0118302_111664Ga0118302_1116641F103019MLFFHHAGKTSSIPPPAGGLSAAIVIVARRGKEYHVVAAVEGHELKTPETEHRPRLERLLETAHLELDGKLFVNTQQAPTWRANCRRFEIGGSLGRRVKCRRVPQPRWVGAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.