NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012249

3300012249: Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 3A3 metaG



Overview

Basic Information
IMG/M Taxon OID3300012249 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111485 | Gp0154760 | Ga0136701
Sample NameFreshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 3A3 metaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21911457
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomebayoufresh water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090615Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136701_100685All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2100Open in IMG/M
Ga0136701_105271Not Available709Open in IMG/M
Ga0136701_107628Not Available570Open in IMG/M
Ga0136701_108674Not Available530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136701_100685Ga0136701_1006851F090615KGWLRPDSSIVDKAAAEGLKKLGVLLCPPPDPDGKSIPERRFIDIATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHGNLVTAIKIANGERLRAAKAKPAAGS*
Ga0136701_105271Ga0136701_1052712F090615ALRVRKGWLRPDSSIVDKAATEGLKKLGALLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAAEAKAAAGS*
Ga0136701_107628Ga0136701_1076281F090615SIVAKAAVEGLTKMGVLLCPPLDPDGKSIPARLFNEIAADYLKAVPQARLLIEESIVEHQAFWDTDKVYVERTDEEIHEKLVTAIKMANADRLRAAKAKAAAGS*
Ga0136701_108674Ga0136701_1086741F090615RKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDPEGKSIPAKLFNEIAAEYLKTVPQTRLLIEESAVEHQAFWDADQPYIDQSDEDIHEEMVTAIKMANADRLRAARAKASAGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.