| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300011990 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113963 | Gp0134651 | Ga0119820 |
| Sample Name | Human oral microbial communities from Los Angeles, CA, USA - S31-01-D |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Los Angeles |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 230871347 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Los Angeles | |||||||
| Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046431 | Metagenome | 151 | Y |
| F063778 | Metagenome | 129 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119820_1010346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces | 2819 | Open in IMG/M |
| Ga0119820_1025057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 1292 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119820_1010346 | Ga0119820_10103464 | F063778 | MPETISEEAQQELLRQLQDALGLVKNADTSALDVAAITHSAADGHQLTEVMLQEMTAARGYLKSCADQINYAISNIEAIPLDPPLED* |
| Ga0119820_1025057 | Ga0119820_10250572 | F046431 | MYKLRKILVTITLVILIITYTQTLVFAAESELTLTPKPETNNIHLKWTGPQNSSYKVYQKKPGSNNFETIGLTDLSREALDEEVKVLNIYPTSDYYNQAVSATGASIPNITVTYLDGQTETIPKSALLKVWMEGRNSNRRKYSNKLSGIW* |
| ⦗Top⦘ |