3300011893: Human oral microbial communities from Los Angeles, CA, USA - S01-05-R

Overview

Basic Information

• IMG/M Taxon OID: 3300011893
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0113963 | Gp0134609 | Ga0119779
• Sample Name: Human oral microbial communities from Los Angeles, CA, USA - S01-05-R
• Sequencing Status: Permanent Draft
• Sequencing Center: University of California, Los Angeles
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 51539479
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Oral Microbial Communities From Los Angeles, Ca, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal secretion

Location Information

• Location: USA: Los Angeles
• Coordinates
  • Lat. (^o): 34.0722
  • Long. (^o): -118.4441
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027205	Metagenome	195	N
F067847	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119779_101040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	5664
Ga0119779_101558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	4457

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119779_101040	Ga0119779_1010401	F027205	LIVSADDILKAVKESEEFERKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIKK*
Ga0119779_101558	Ga0119779_1015585	F067847	MFSHIIRVRGIFDDEPTTKKLYFHMSRREMFDFIKRYDNVTNFEKWLQAAIDNEDLYTMMKFFDDLIGTSYGERQGERFVKSEQIKESFLNSPEYEELFDQLMDNPSLVREFYNGILPEKIMKQVQQDPKYKELDAKLKETELNNL*