3300011448: Fecal viral communites from wild urban brown rats in Berlin, Germany - Mu/10/1772

Overview

Basic Information

• IMG/M Taxon OID: 3300011448
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118649 | Gp0138569 | Ga0120365
• Sample Name: Fecal viral communites from wild urban brown rats in Berlin, Germany - Mu/10/1772
• Sequencing Status: Permanent Draft
• Sequencing Center: Freie University Berlin
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 2379585
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Fecal Viral Communites From Wild Urban Brown Rats In Berlin, Germany
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Viral Communites From Wild Urban Brown Rats In Berlin, Germany

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Germany: Berlin
• Coordinates
  • Lat. (^o): 52.529611
  • Long. (^o): 13.401343
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053097	Metagenome / Metatranscriptome	141	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0120365_10080	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1093

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120365_10080	Ga0120365_100801	F053097	AIPPFKDFYNKSKDKQDAIKKIEFIIWRYKWNTPYEAYPEKERTWRVAKDVFNDEHYVPDADVQELAKRFNEF*