3300011278: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP199 (Metagenome Metatranscriptome) (version 2)

Overview

Basic Information

• IMG/M Taxon OID: 3300011278
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0092414 | Ga0138353
• Sample Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP199 (Metagenome Metatranscriptome) (version 2)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 17641608
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora	1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: South of Cape Verde, Atlantic Ocean
• Coordinates
  • Lat. (^o): 7.32
  • Long. (^o): -26.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003009	Metagenome / Metatranscriptome	513	Y
F044934	Metagenome / Metatranscriptome	153	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0138353_114431	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora	2007
Ga0138353_121700	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	1199

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0138353_114431	Ga0138353_1144312	F044934	VFAGLSSTVSFTNLLITRRTLSMPGMRHRRVLLPFVTIGTLFALRMLAIITPVLGAAMIMMMLDRH*
Ga0138353_121700	Ga0138353_1217002	F003009	GSYYNLGIRSIYHYFAVLAVSFHDIHSLFGFFTFLTVASQLVSGTMLAFSLVPEPMIVPIVRNEEDMEDLYTDDFF*