| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300011274 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114292 | Gp0125891 | Ga0138378 |
| Sample Name | Marine microbial communities from the Southern Atlantic ocean - KN S15 250m_B metaT (Metagenome Metatranscriptome) (version 2) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2672901 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Southern Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021393 | Metagenome / Metatranscriptome | 219 | N |
| F076161 | Metagenome / Metatranscriptome | 118 | N |
| F103410 | Metagenome / Metatranscriptome | 101 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0138378_11692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 | 534 | Open in IMG/M |
| Ga0138378_14074 | Not Available | 515 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0138378_11692 | Ga0138378_116921 | F076161 | INFASRCPKTDFRAFAENPVAKSLLLPQFGGQKVPPQGASIPYRLTAWTVPQIAADPKERNNLLSSPTNPDAPTGKPV* |
| Ga0138378_14074 | Ga0138378_140741 | F021393 | VKSGFDTLTEVVQSIAESQKATQEVLGGLDNRLKALETPSDLPLTPKGTAAGDDVGAKVTVPKDPYPQGVQAGLDDDRNGEGKPASDKGGLKMQKKSEDDTELIEKAEHTFSTETPRPNAALETVDKSIKDSSLILKDARAEGFEGLSVVARNILSGKYYVPSDDEVRGF* |
| Ga0138378_16377 | Ga0138378_163771 | F103410 | SRSLVVKKCRPKGLQSLIASLPGLSHKSPQTRRSAATCFLAQPIPTQPRASPFDALISLPAQHVLGRTPEGTSRTVLTDQIGLPKVSRPPQRRTFLHHPEASLEHASFRLPYHKTARKLFSNTADHFCQHLRRHARVPDPCLAHRHSNDPKITFLPISLAFDRLAQGPHDPGHTTPKGFACRFGCSTDPLLPGGIATTMSQPSQSTQRLLGHLSLCRTIRPEGHIEGFGSRNTIHFNHSKVTRSGTFQPFPTNGWFTYPGLSAPQRPRCVMLKLLKAVA |
| ⦗Top⦘ |