x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300011239
3300011239: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 1 - S13.2.10.a - transect 2, age 0 years, surface depth)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300011239 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121480 | Gp0155447 | Ga0137006 |
| Sample Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 1 - S13.2.10.a - transect 2, age 0 years, surface depth) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Bristol |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 33376241 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Metagenomes Of Arctic Soils |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | terrestrial biome → glacial feature → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information |
| Location | Norway: Midre Lovenbreen, Svalbard |
| Coordinates | Lat. (o) | 79.1005 | Long. (o) | 12.15611 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F045483 | Metagenome | 152 | N |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0137006_108360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium | 676 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0137006_108360 | Ga0137006_1083601 | F045483 | VTETRRQSTRLANPRRLFSGLSVLGLSLFVLTGCVVPGGYDVNSLHLLPESGLVYPGSTGVHTNDYGGSPGNYIGKGAVAATGKSATTVHTQLEVLAYFSQTLAADGWTQTAADDTATTPEGFRAKDISWVKNSLHLSYLVVVWTVGETTHYDTQLSANE* |
