3300011193: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 12 - S13.3.50.a - transect 3, age 50 years, surface depth).

Overview

Basic Information

• IMG/M Taxon OID: 3300011193
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121480 | Gp0155465 | Ga0137477
• Sample Name: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 12 - S13.3.50.a - transect 3, age 50 years, surface depth).
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Bristol
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 4751816
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Metagenomes Of Arctic Soils
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → glacial feature → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Midre Lovenbreen, Svalbard, Norway
• Coordinates
  • Lat. (^o): 78.90777778
  • Long. (^o): 12.16444444
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011197	Metagenome / Metatranscriptome	294	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0137477_100439	All Organisms → cellular organisms → Bacteria	657

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0137477_100439	Ga0137477_1004391	F011197	RGVAAVAPYDSPGFRSPDWVGFQWDSVDTRAVAYPGLPGRWRGAPYDFVDGGEGLDIAGLPDEVLGCLAGT*