3300011111: Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2

Overview

Basic Information

• IMG/M Taxon OID: 3300011111
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121704 | Gp0173492 | Ga0151501
• Sample Name: Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2
• Sequencing Status: Permanent Draft
• Sequencing Center: Toyama Prefectural University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 98440549
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → unclassified Ignavibacteriota → Ignavibacteriae bacterium HGW-Ignavibacteriae-4	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Dna From Seawater And Marine Sediment
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Japan Sea near Toyama Prefecture, JAPAN
• Coordinates
  • Lat. (^o): 37.035
  • Long. (^o): 137.41472
  • Alt. (m): N/A
  • Depth (m): 803

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000352	Metagenome / Metatranscriptome	1247	Y
F015879	Metagenome	251	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0151501_1018004	Not Available	712
Ga0151501_1054896	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → unclassified Ignavibacteriota → Ignavibacteriae bacterium HGW-Ignavibacteriae-4	697

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0151501_1018004	Ga0151501_10180043	F000352	MKTIKLTEGDAIFVHYVLRMYANQTAGLDSEDKVEI*
Ga0151501_1054896	Ga0151501_10548961	F015879	DVIIISCNVCGAMSHAIKTKILKGYYVKDEFVVCKICFGELK*