3300010940: Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C0

Overview

Basic Information

• IMG/M Taxon OID: 3300010940
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121583 | Gp0157198 | Ga0139172
• Sample Name: Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C0
• Sequencing Status: Permanent Draft
• Sequencing Center: Autonomous University of Barcelona
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3499041
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Alicante,Spain
• Coordinates
  • Lat. (^o): 38.34
  • Long. (^o): -0.48
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082719	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0139172_11369	Not Available	671

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0139172_11369	Ga0139172_113692	F082719	MAGRQQDFISNARTVNKQIWDGINALVAMQHEWTALDYGNTLEDGEGGNADYTALEVGAVVFDTANAMVAVLAAGQATNMAKLL*