Basic Information | |
---|---|
IMG/M Taxon OID | 3300010259 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120398 | Gp0147152 | Ga0129316 |
Sample Name | Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm1022B metagenome |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 118426464 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.78 | Long. (o) | -88.79 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013656 | Metagenome | 269 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0129316_1049521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 503 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0129316_1049521 | Ga0129316_10495212 | F013656 | MKDKIYKEPLKSEEETTINVLYSENVLSIYTNKVGLQKQLNKLIGEPTKEDKIKRSIAGSRWEIPLSDKTRISRMVLKANLFEL* |
⦗Top⦘ |