3300010221: Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 1

Overview

Basic Information

• IMG/M Taxon OID: 3300010221
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121426 | Gp0154196 | Ga0136259
• Sample Name: Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 1
• Sequencing Status: Permanent Draft
• Sequencing Center: Fidelity Systems Inc
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 102662290
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Freshwater Microbial Communities Enriched With Nitrile Substrates
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → aquifer → fresh water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Bangor, North Wales, UK
• Coordinates
  • Lat. (^o): 53.23
  • Long. (^o): -4.13
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025287	Metagenome / Metatranscriptome	202	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0136259_112149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1007

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136259_112149	Ga0136259_1121492	F025287	MGKDMIVSVDVYTKDVDAALAAFKLAIESGATNVRLSSNEDYDTKKFENLNLMFEANHTSAAISKLDEGPXXXXXX