3300010053: Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA

Overview

Basic Information

• IMG/M Taxon OID: 3300010053
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121386 | Gp0153999 | Ga0134290
• Sample Name: Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Barcelona
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 144656856
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Odonata → Zygoptera → Coenagrionoidea → Coenagrionidae → Ischnura → Ischnura elegans	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Insect Gut Microbial Communities From Cryptocercus Cockroaches From Viginia, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Intestinal Tract → Insect Gut Microbial Communities From Cryptocercus Cockroaches From Viginia, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Virginia, USA
• Coordinates
  • Lat. (^o): 37.5
  • Long. (^o): -79.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052004	Metagenome	143	Y
F076214	Metagenome	118	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134290_1062894	Not Available	531
Ga0134290_1067982	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Odonata → Zygoptera → Coenagrionoidea → Coenagrionidae → Ischnura → Ischnura elegans	688

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134290_1062894	Ga0134290_10628941	F052004	MDVGGEDARWVELAQDRVQWRALVLSMLNLRDLLPES*
Ga0134290_1067982	Ga0134290_10679821	F076214	DRLREFLDNYDVAFELVSEDKHDILLKFVKAKITGEARSKLMVRDLTDTWEQVRSILEENYAVKRTLDFYACKMFNAKQGKEEGVANWGSRIDGHQTQLREAARRICKKEEIVGAVALIGHLGKACFVQGLANDRIQTVVRSRGESILLSSAIELALEEESAYFVSQGERRI*