3300010012: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #1 sample B1

Overview

Basic Information

• IMG/M Taxon OID: 3300010012
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0120461 | Gp0149151 | Ga0133895
• Sample Name: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #1 sample B1
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Maryland
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 48742759
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Black Band Disease Transitions
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: Belize: Carrie Bow Cay Field Station
• Coordinates
  • Lat. (^o): 16.80288
  • Long. (^o): -88.08213
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017437	Metagenome / Metatranscriptome	240	Y
F082762	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0133895_1004765	Not Available	799
Ga0133895_1007707	Not Available	639

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0133895_1004765	Ga0133895_10047651	F082762	SGANITNSTSPLMLTKNITLTVVDCCAPPPVRLAFHCAGVVATIGASIAAPSPITIGSAIHLLSEIYEEC*
Ga0133895_1007707	Ga0133895_10077071	F017437	MGRKLLFVVPLTNAQLHLTKRKMSSNGSANVKHSEAMSDEIVTAMSTACGASIFLFELFKKNLESICCPSYEMNAGSWQAWVLIT*